PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000537324
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family MYB
Protein Properties Length: 226aa    MW: 25772 Da    PI: 7.2533
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000537324genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.92e-17956148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g WT+eEde+l+d+++ +G g+W++I++  g++R++k+c++rw+++l
    MDP0000537324  9 KGLWTKEEDEILLDYIRVHGRGRWNRIPKVTGLRRSGKSCRLRWLNHL 56
                     678*******************************************97 PP

2Myb_DNA-binding57.72.6e-1862107148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg +++eE++l+++++++lG++ W++Ia +++ gRt++q+k++w+++l
    MDP0000537324  62 RGDFSEEEEDLIIRLHNLLGNR-WSLIAGRVP-GRTDNQVKNYWNTHL 107
                      899*******************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.83156IPR017930Myb domain
SuperFamilySSF466893.4E-307103IPR009057Homeodomain-like
SMARTSM007172.3E-15858IPR001005SANT/Myb domain
PfamPF002491.6E-15956IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.9E-231063IPR009057Homeodomain-like
CDDcd001675.03E-121256No hitNo description
PROSITE profilePS5129426.22557111IPR017930Myb domain
SMARTSM007176.5E-1761109IPR001005SANT/Myb domain
PfamPF002492.3E-1762107IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-2564111IPR009057Homeodomain-like
CDDcd001674.05E-1265107No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 226 aa     Download sequence    Send to blast
MEAEYEYKKG LWTKEEDEIL LDYIRVHGRG RWNRIPKVTG LRRSGKSCRL RWLNHLSPNV  60
KRGDFSEEEE DLIIRLHNLL GNRWSLIAGR VPGRTDNQVK NYWNTHLYKK LNAIKKQQTS  120
GKVAVVSTSK TTTHSSSAAQ ELAGDKLVHQ HKMLKAPDSD SNSVTKSNDQ NPNMDIVAAE  180
DSNAEEEEIE WMAKHCTELL SCSSYGNMIS WDTVEFLQGY PLDLL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C5e-28611124128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008389647.11e-169PREDICTED: transcription factor WER-like
SwissprotQ962762e-64MYB23_ARATH; Transcription factor MYB23
TrEMBLM5XZK03e-93M5XZK0_PRUPE; Uncharacterized protein
STRINGVIT_01s0127g00730.t019e-68(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3134817
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G14750.11e-62myb domain protein 66